PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004488426.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27876.8 Da    PI: 8.9778
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004488426.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.3e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeyss
  XP_004488426.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.744161IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-35293IPR002100Transcription factor, MADS-box
CDDcd002651.31E-43279No hitNo description
PRINTSPR004044.2E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-323859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-2784172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.45188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFSN KGKLYEYSSD  60
PCMERILERY ERYSYAERQL VATDQPQNEN WIIEHAKLKA RLEIIQRNQR NFMGEELDGL  120
SIKELQNLEH QLDSALKQIR SRKNQLMYES ISELHKKDKA LQEKNNLLVK KIKEKEKELA  180
QLEQQYDAID LTSTVLASQP LETLNIGGSP QGRGDGEDNE GNQTRVNTLF PPWMLRPVNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q6e-22174173Myocyte-specific enhancer factor 2B
1tqe_R6e-22174173Myocyte-specific enhancer factor 2B
1tqe_S6e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0527040.0BT052704.1 Medicago truncatula clone MTYFD_FE_FF_FG1G-I-18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004488426.11e-177PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ388761e-111AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBLQ56NI71e-143Q56NI7_PEA; MADS box protein M2
STRINGGLYMA06G22650.21e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-100AGAMOUS-like 8